PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012569502.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MYB
Protein Properties Length: 336aa    MW: 38465 Da    PI: 6.5932
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012569502.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++q+G g+W+++++  g+ R++k+c++rw +yl
   XP_012569502.1 14 KGLWSPEEDEKLLKHITQFGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding46.39.5e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +++eE+ l+++++  lG++ W+ Ia+ ++ gRt++++k+ w++
   XP_012569502.1  67 RGTFSQEEENLIIELHSVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.284961IPR017930Myb domain
SuperFamilySSF466893.67E-2912108IPR009057Homeodomain-like
SMARTSM007171.1E-121363IPR001005SANT/Myb domain
PfamPF002495.8E-151461IPR001005SANT/Myb domain
CDDcd001671.31E-101761No hitNo description
PROSITE profilePS5129425.77362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.0E-2665116IPR009057Homeodomain-like
SMARTSM007172.9E-1366114IPR001005SANT/Myb domain
PfamPF002491.4E-1367111IPR001005SANT/Myb domain
CDDcd001677.73E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLKHIT QFGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQEEENLIIE LHSVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQKG  120
IDPLTHKPIS EAENGDEEKV GEVSDELNLV RSESFKSDAG SYEQKQSSII LKGYPNEMEL  180
EGKSKSDSNM LTNNKDLAYE RFMTSQQESY TNNNCQHIDL MGNYSIQMNN LPTNSNSSHW  240
FNQTGKVPFD MNSEFTSNSN IMSILPPTTS SFCYKPSEDV SISSGSFHVN NNNGSNYWEE  300
EEVKWCEYLH NPMLMLQNQA PESLCNQIKP ATNFVP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0528491e-170BT052849.1 Medicago truncatula clone MTYFL_FM_FN_FO1G-P-4 unknown mRNA.
GenBankBT1474771e-170BT147477.1 Medicago truncatula clone JCVI-FLMt-12D24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012569502.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLA0A0B2SGD11e-161A0A0B2SGD1_GLYSO; Transcription factor MYB86
STRINGGLYMA19G41010.21e-158(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.32e-91myb domain protein 55